Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4619736..4620439 | Replicon | chromosome |
Accession | NZ_CP103548 | ||
Organism | Klebsiella pneumoniae strain 3987 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | M5T27_RS22485 | Protein ID | WP_071994632.1 |
Coordinates | 4620098..4620439 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | M5T27_RS22480 | Protein ID | WP_032434296.1 |
Coordinates | 4619736..4620077 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T27_RS22445 (4614891) | 4614891..4615765 | + | 875 | Protein_4381 | GTPase family protein | - |
M5T27_RS22450 (4616009) | 4616009..4616725 | + | 717 | WP_032434305.1 | WYL domain-containing protein | - |
M5T27_RS22455 (4616761) | 4616761..4617213 | + | 453 | WP_032410767.1 | hypothetical protein | - |
M5T27_RS22460 (4617285) | 4617285..4617758 | + | 474 | WP_032434303.1 | hypothetical protein | - |
M5T27_RS22465 (4617878) | 4617878..4618699 | + | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
M5T27_RS22470 (4618730) | 4618730..4619170 | + | 441 | WP_032434300.1 | antirestriction protein | - |
M5T27_RS22475 (4619183) | 4619183..4619725 | + | 543 | WP_032434298.1 | DNA repair protein RadC | - |
M5T27_RS22480 (4619736) | 4619736..4620077 | + | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T27_RS22485 (4620098) | 4620098..4620439 | + | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
M5T27_RS22490 (4620631) | 4620631..4622664 | - | 2034 | WP_050598589.1 | hypothetical protein | - |
M5T27_RS22495 (4623255) | 4623255..4624124 | - | 870 | WP_023317468.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4587142..4632720 | 45578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T255447 WP_071994632.1 NZ_CP103548:4620098-4620439 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|