Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4527195..4527711 | Replicon | chromosome |
| Accession | NZ_CP103548 | ||
| Organism | Klebsiella pneumoniae strain 3987 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5T27_RS22095 | Protein ID | WP_004178374.1 |
| Coordinates | 4527427..4527711 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | M5T27_RS22090 | Protein ID | WP_032434351.1 |
| Coordinates | 4527195..4527437 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T27_RS22075 (4523224) | 4523224..4523964 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| M5T27_RS22080 (4524030) | 4524030..4525184 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5T27_RS22085 (4525207) | 4525207..4527117 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5T27_RS22090 (4527195) | 4527195..4527437 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5T27_RS22095 (4527427) | 4527427..4527711 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T27_RS22100 (4527715) | 4527715..4528179 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5T27_RS22105 (4528421) | 4528421..4530559 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5T27_RS22110 (4530916) | 4530916..4531659 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5T27_RS22115 (4531662) | 4531662..4531835 | - | 174 | WP_032414379.1 | hypothetical protein | - |
| M5T27_RS22120 (4531920) | 4531920..4532228 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255446 WP_004178374.1 NZ_CP103548:4527427-4527711 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|