Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3168631..3169288 | Replicon | chromosome |
Accession | NZ_CP103548 | ||
Organism | Klebsiella pneumoniae strain 3987 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | M5T27_RS15485 | Protein ID | WP_002916310.1 |
Coordinates | 3168631..3169041 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M5T27_RS15490 | Protein ID | WP_002916312.1 |
Coordinates | 3169022..3169288 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T27_RS15465 (3164631) | 3164631..3166364 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5T27_RS15470 (3166370) | 3166370..3167083 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5T27_RS15475 (3167106) | 3167106..3168002 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M5T27_RS15480 (3168103) | 3168103..3168624 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
M5T27_RS15485 (3168631) | 3168631..3169041 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
M5T27_RS15490 (3169022) | 3169022..3169288 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M5T27_RS15495 (3169534) | 3169534..3170517 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
M5T27_RS15500 (3170616) | 3170616..3171275 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
M5T27_RS15505 (3171439) | 3171439..3171750 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M5T27_RS15510 (3171800) | 3171800..3172528 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M5T27_RS15515 (3172647) | 3172647..3174080 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T255441 WP_002916310.1 NZ_CP103548:c3169041-3168631 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |