Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 94065..94590 | Replicon | plasmid pMB9029_2 |
Accession | NZ_CP103546 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | M5S54_RS24270 | Protein ID | WP_001159871.1 |
Coordinates | 94065..94370 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | M5S54_RS24275 | Protein ID | WP_000813630.1 |
Coordinates | 94372..94590 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS24245 (90236) | 90236..90652 | - | 417 | WP_001278818.1 | plasmid partitioning/stability family protein | - |
M5S54_RS24250 (90645) | 90645..91625 | - | 981 | WP_000688514.1 | plasmid segregation protein ParM | - |
M5S54_RS24255 (92039) | 92039..92347 | - | 309 | WP_000030199.1 | hypothetical protein | - |
M5S54_RS24260 (92434) | 92434..93078 | - | 645 | WP_001144036.1 | ParA family protein | - |
M5S54_RS24265 (93258) | 93258..94064 | - | 807 | WP_000016969.1 | site-specific integrase | - |
M5S54_RS24270 (94065) | 94065..94370 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M5S54_RS24275 (94372) | 94372..94590 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M5S54_RS24280 (95148) | 95148..96074 | + | 927 | WP_001290416.1 | hypothetical protein | - |
M5S54_RS24285 (96119) | 96119..96373 | + | 255 | WP_000678527.1 | hypothetical protein | - |
M5S54_RS24290 (96872) | 96872..97216 | + | 345 | WP_000793307.1 | hypothetical protein | - |
M5S54_RS24295 (97392) | 97392..98393 | - | 1002 | WP_000774875.1 | DUF4238 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-2 | - | 1..98998 | 98998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T255433 WP_001159871.1 NZ_CP103546:c94370-94065 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |