Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 77155..77780 | Replicon | plasmid pMB9029_1 |
| Accession | NZ_CP103545 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5S54_RS23385 | Protein ID | WP_000911313.1 |
| Coordinates | 77382..77780 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | M5S54_RS23380 | Protein ID | WP_000450520.1 |
| Coordinates | 77155..77382 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS23380 (77155) | 77155..77382 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| M5S54_RS23385 (77382) | 77382..77780 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S54_RS23390 (77789) | 77789..79951 | - | 2163 | WP_023352413.1 | type IV conjugative transfer system coupling protein TraD | - |
| M5S54_RS23395 (80204) | 80204..80935 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| M5S54_RS23400 (80967) | 80967..81464 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132824 | 132824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T255424 WP_000911313.1 NZ_CP103545:77382-77780 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|