Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 20592..21235 | Replicon | plasmid pMB9029_1 |
Accession | NZ_CP103545 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | M5S54_RS23060 | Protein ID | WP_001044768.1 |
Coordinates | 20819..21235 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | M5S54_RS23055 | Protein ID | WP_001261287.1 |
Coordinates | 20592..20822 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS23035 (15752) | 15752..16840 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
M5S54_RS23040 (16842) | 16842..19067 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
M5S54_RS23045 (19117) | 19117..20016 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
M5S54_RS23050 (20006) | 20006..20296 | - | 291 | WP_000111771.1 | hypothetical protein | - |
M5S54_RS23055 (20592) | 20592..20822 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5S54_RS23060 (20819) | 20819..21235 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S54_RS23065 (21397) | 21397..23535 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
M5S54_RS23070 (23889) | 23889..24146 | + | 258 | WP_000343085.1 | hypothetical protein | - |
M5S54_RS23075 (24146) | 24146..24736 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132824 | 132824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T255419 WP_001044768.1 NZ_CP103545:20819-21235 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |