Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 14658..15183 Replicon plasmid pMB9029_1
Accession NZ_CP103545
Organism Escherichia coli strain 3036

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag M5S54_RS23025 Protein ID WP_001159871.1
Coordinates 14658..14963 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag M5S54_RS23030 Protein ID WP_000813630.1
Coordinates 14965..15183 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S54_RS22985 (10167) 10167..10364 - 198 Protein_10 colicin V -
M5S54_RS22990 (10342) 10342..10578 - 237 WP_014640552.1 colicin V immunity protein -
M5S54_RS22995 (11120) 11120..11323 - 204 Protein_12 hypothetical protein -
M5S54_RS23000 (11496) 11496..11663 + 168 Protein_13 colicin-B -
M5S54_RS23005 (11681) 11681..12208 - 528 WP_000203272.1 colicin B immunity protein -
M5S54_RS23010 (12452) 12452..13267 + 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
M5S54_RS23015 (13317) 13317..13670 - 354 WP_000864812.1 colicin M immunity protein -
M5S54_RS23020 (13848) 13848..14657 - 810 WP_060588703.1 site-specific integrase -
M5S54_RS23025 (14658) 14658..14963 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
M5S54_RS23030 (14965) 14965..15183 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M5S54_RS23035 (15752) 15752..16840 + 1089 WP_000952217.1 transcriptional repressor PifC -
M5S54_RS23040 (16842) 16842..19067 + 2226 WP_000698737.1 P-loop NTPase fold protein -
M5S54_RS23045 (19117) 19117..20016 - 900 WP_000963206.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD iutA / iucD / iucC / iucB / iucA 1..132824 132824


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T255418 WP_001159871.1 NZ_CP103545:c14963-14658 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT255418 WP_000813630.1 NZ_CP103545:c15183-14965 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References