Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 14658..15183 | Replicon | plasmid pMB9029_1 |
| Accession | NZ_CP103545 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | M5S54_RS23025 | Protein ID | WP_001159871.1 |
| Coordinates | 14658..14963 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | M5S54_RS23030 | Protein ID | WP_000813630.1 |
| Coordinates | 14965..15183 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS22985 (10167) | 10167..10364 | - | 198 | Protein_10 | colicin V | - |
| M5S54_RS22990 (10342) | 10342..10578 | - | 237 | WP_014640552.1 | colicin V immunity protein | - |
| M5S54_RS22995 (11120) | 11120..11323 | - | 204 | Protein_12 | hypothetical protein | - |
| M5S54_RS23000 (11496) | 11496..11663 | + | 168 | Protein_13 | colicin-B | - |
| M5S54_RS23005 (11681) | 11681..12208 | - | 528 | WP_000203272.1 | colicin B immunity protein | - |
| M5S54_RS23010 (12452) | 12452..13267 | + | 816 | WP_001312845.1 | lipid II-degrading bacteriocin colicin M | - |
| M5S54_RS23015 (13317) | 13317..13670 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
| M5S54_RS23020 (13848) | 13848..14657 | - | 810 | WP_060588703.1 | site-specific integrase | - |
| M5S54_RS23025 (14658) | 14658..14963 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M5S54_RS23030 (14965) | 14965..15183 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M5S54_RS23035 (15752) | 15752..16840 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| M5S54_RS23040 (16842) | 16842..19067 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| M5S54_RS23045 (19117) | 19117..20016 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / catA2 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132824 | 132824 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T255418 WP_001159871.1 NZ_CP103545:c14963-14658 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |