Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3476629..3477466 | Replicon | chromosome |
Accession | NZ_CP103544 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | M5S54_RS16815 | Protein ID | WP_000227784.1 |
Coordinates | 3476924..3477466 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | M5S54_RS16810 | Protein ID | WP_001297137.1 |
Coordinates | 3476629..3476940 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS16785 (3471649) | 3471649..3472596 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
M5S54_RS16790 (3472618) | 3472618..3474609 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
M5S54_RS16795 (3474599) | 3474599..3475213 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M5S54_RS16800 (3475213) | 3475213..3475542 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M5S54_RS16805 (3475554) | 3475554..3476444 | + | 891 | WP_000971336.1 | heme o synthase | - |
M5S54_RS16810 (3476629) | 3476629..3476940 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
M5S54_RS16815 (3476924) | 3476924..3477466 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
M5S54_RS16820 (3477522) | 3477522..3478457 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
M5S54_RS16825 (3478865) | 3478865..3480229 | + | 1365 | WP_001000978.1 | MFS transporter | - |
M5S54_RS16830 (3480357) | 3480357..3480848 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
M5S54_RS16835 (3481016) | 3481016..3481927 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T255413 WP_000227784.1 NZ_CP103544:3476924-3477466 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|