Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3442552..3443170 | Replicon | chromosome |
Accession | NZ_CP103544 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5S54_RS16645 | Protein ID | WP_001291435.1 |
Coordinates | 3442952..3443170 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5S54_RS16640 | Protein ID | WP_000344800.1 |
Coordinates | 3442552..3442926 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS16630 (3437641) | 3437641..3438834 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5S54_RS16635 (3438857) | 3438857..3442006 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M5S54_RS16640 (3442552) | 3442552..3442926 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5S54_RS16645 (3442952) | 3442952..3443170 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5S54_RS16650 (3443342) | 3443342..3443893 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
M5S54_RS16655 (3444009) | 3444009..3444479 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5S54_RS16660 (3444643) | 3444643..3446193 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5S54_RS16665 (3446235) | 3446235..3446588 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5S54_RS16675 (3446967) | 3446967..3447278 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5S54_RS16680 (3447309) | 3447309..3447881 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255412 WP_001291435.1 NZ_CP103544:3442952-3443170 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255412 WP_000344800.1 NZ_CP103544:3442552-3442926 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |