Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2470770..2471408 | Replicon | chromosome |
Accession | NZ_CP103544 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M5S54_RS11955 | Protein ID | WP_000813794.1 |
Coordinates | 2471232..2471408 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5S54_RS11950 | Protein ID | WP_001270286.1 |
Coordinates | 2470770..2471186 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS11930 (2465922) | 2465922..2466863 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
M5S54_RS11935 (2466864) | 2466864..2467877 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M5S54_RS11940 (2467895) | 2467895..2469040 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
M5S54_RS11945 (2469285) | 2469285..2470691 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
M5S54_RS11950 (2470770) | 2470770..2471186 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5S54_RS11955 (2471232) | 2471232..2471408 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5S54_RS11960 (2471630) | 2471630..2471860 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5S54_RS11965 (2471952) | 2471952..2473913 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5S54_RS11970 (2473986) | 2473986..2474522 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
M5S54_RS11975 (2474614) | 2474614..2475789 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2475829..2477094 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T255410 WP_000813794.1 NZ_CP103544:c2471408-2471232 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255410 WP_001270286.1 NZ_CP103544:c2471186-2470770 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|