Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1813703..1814534 Replicon chromosome
Accession NZ_CP103544
Organism Escherichia coli strain 3036

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M5S54_RS08640 Protein ID WP_000854814.1
Coordinates 1813703..1814077 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag M5S54_RS08645 Protein ID WP_001285585.1
Coordinates 1814166..1814534 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S54_RS08595 (1809105) 1809105..1809578 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
M5S54_RS08600 (1809776) 1809776..1810327 + 552 Protein_1678 FUSC family protein -
M5S54_RS08605 (1810520) 1810520..1811500 + 981 WP_000399648.1 IS110-like element IS621 family transposase -
M5S54_RS08610 (1811595) 1811595..1812113 + 519 Protein_1680 hypothetical protein -
M5S54_RS08615 (1812285) 1812285..1812614 + 330 WP_000450409.1 DUF496 family protein -
M5S54_RS08620 (1812715) 1812715..1812849 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
M5S54_RS08625 (1812969) 1812969..1813097 + 129 Protein_1683 transposase domain-containing protein -
M5S54_RS08630 (1813386) 1813386..1813466 - 81 Protein_1684 hypothetical protein -
M5S54_RS08635 (1813512) 1813512..1813706 - 195 WP_000988600.1 DUF5983 family protein -
M5S54_RS08640 (1813703) 1813703..1814077 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5S54_RS08645 (1814166) 1814166..1814534 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M5S54_RS08650 (1814608) 1814608..1814829 - 222 WP_000692323.1 DUF987 domain-containing protein -
M5S54_RS08655 (1814892) 1814892..1815368 - 477 WP_001186773.1 RadC family protein -
M5S54_RS08660 (1815384) 1815384..1815764 - 381 WP_096257200.1 antirestriction protein -
M5S54_RS08665 (1815846) 1815846..1816667 - 822 WP_101942925.1 DUF932 domain-containing protein -
M5S54_RS08670 (1816888) 1816888..1817298 - 411 WP_000846713.1 hypothetical protein -
M5S54_RS08675 (1817314) 1817314..1817997 - 684 WP_000775500.1 hypothetical protein -
M5S54_RS08680 (1818133) 1818133..1819203 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1810520..1811500 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T255404 WP_000854814.1 NZ_CP103544:c1814077-1813703 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT255404 WP_001285585.1 NZ_CP103544:c1814534-1814166 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References