Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1287316..1287941 | Replicon | chromosome |
Accession | NZ_CP103544 | ||
Organism | Escherichia coli strain 3036 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5S54_RS06225 | Protein ID | WP_000911330.1 |
Coordinates | 1287543..1287941 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | M5S54_RS06220 | Protein ID | WP_000450524.1 |
Coordinates | 1287316..1287543 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S54_RS06195 (1283119) | 1283119..1283589 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
M5S54_RS06200 (1283589) | 1283589..1284161 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
M5S54_RS06205 (1284307) | 1284307..1285185 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M5S54_RS06210 (1285202) | 1285202..1286236 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
M5S54_RS06215 (1286449) | 1286449..1287162 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
M5S54_RS06220 (1287316) | 1287316..1287543 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M5S54_RS06225 (1287543) | 1287543..1287941 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S54_RS06230 (1288088) | 1288088..1288951 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
M5S54_RS06235 (1288966) | 1288966..1290981 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
M5S54_RS06240 (1291055) | 1291055..1291753 | + | 699 | WP_000679823.1 | esterase | - |
M5S54_RS06245 (1291863) | 1291863..1292063 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T255402 WP_000911330.1 NZ_CP103544:1287543-1287941 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|