Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 863172..863826 | Replicon | chromosome |
| Accession | NZ_CP103544 | ||
| Organism | Escherichia coli strain 3036 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | M5S54_RS04200 | Protein ID | WP_000244772.1 |
| Coordinates | 863419..863826 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | M5S54_RS04195 | Protein ID | WP_063100142.1 |
| Coordinates | 863172..863438 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S54_RS04170 (858460) | 858460..859203 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| M5S54_RS04175 (859260) | 859260..860693 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| M5S54_RS04180 (860738) | 860738..861049 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5S54_RS04185 (861213) | 861213..861872 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M5S54_RS04190 (861949) | 861949..862929 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| M5S54_RS04195 (863172) | 863172..863438 | + | 267 | WP_063100142.1 | FAD assembly factor SdhE | Antitoxin |
| M5S54_RS04200 (863419) | 863419..863826 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| M5S54_RS04205 (863866) | 863866..864387 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M5S54_RS04210 (864499) | 864499..865395 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M5S54_RS04215 (865420) | 865420..866130 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5S54_RS04220 (866136) | 866136..867869 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T255400 WP_000244772.1 NZ_CP103544:863419-863826 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|