Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 125001..125560 Replicon plasmid pMB9081_1
Accession NZ_CP103541
Organism Escherichia coli strain 5264

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag M5S66_RS23625 Protein ID WP_000421272.1
Coordinates 125285..125560 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag M5S66_RS23620 Protein ID WP_001387467.1
Coordinates 125001..125285 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S66_RS23590 (120469) 120469..120816 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
M5S66_RS23595 (120933) 120933..121771 - 839 Protein_143 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
M5S66_RS23600 (121777) 121777..122067 - 291 WP_001336345.1 DUF1010 domain-containing protein -
M5S66_RS23605 (122179) 122179..122676 - 498 WP_001083725.1 trimethoprim-resistant dihydrofolate reductase DfrA12 -
M5S66_RS23610 (122821) 122821..123687 + 867 Protein_146 class 1 integron integrase IntI1 -
M5S66_RS23615 (123742) 123742..124446 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M5S66_RS23620 (125001) 125001..125285 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
M5S66_RS23625 (125285) 125285..125560 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S66_RS23635 (126443) 126443..126646 + 204 Protein_151 hypothetical protein -
M5S66_RS23640 (126771) 126771..126899 - 129 Protein_152 IS481 family transposase -
M5S66_RS23645 (126932) 126932..128101 - 1170 WP_001072355.1 hypothetical protein -
M5S66_RS23650 (128633) 128633..128901 + 269 Protein_154 type II toxin-antitoxin system ParD family antitoxin -
M5S66_RS23655 (128888) 128888..129177 + 290 Protein_155 type II toxin-antitoxin system RelE/ParE family toxin -
M5S66_RS23660 (129244) 129244..129426 + 183 WP_042344623.1 hypothetical protein -
M5S66_RS23665 (129547) 129547..130287 + 741 WP_001066953.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / mph(A) / blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 - 1..140210 140210


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T255396 WP_000421272.1 NZ_CP103541:125285-125560 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT255396 WP_001387467.1 NZ_CP103541:125001-125285 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References