Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3446206..3446824 | Replicon | chromosome |
Accession | NZ_CP103540 | ||
Organism | Escherichia coli strain 5264 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5S66_RS16665 | Protein ID | WP_001291435.1 |
Coordinates | 3446606..3446824 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5S66_RS16660 | Protein ID | WP_000344800.1 |
Coordinates | 3446206..3446580 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S66_RS16650 (3441295) | 3441295..3442488 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5S66_RS16655 (3442511) | 3442511..3445660 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M5S66_RS16660 (3446206) | 3446206..3446580 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5S66_RS16665 (3446606) | 3446606..3446824 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5S66_RS16670 (3446996) | 3446996..3447547 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M5S66_RS16675 (3447663) | 3447663..3448133 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5S66_RS16680 (3448297) | 3448297..3449847 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5S66_RS16685 (3449889) | 3449889..3450242 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M5S66_RS16695 (3450621) | 3450621..3450932 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M5S66_RS16700 (3450963) | 3450963..3451535 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255390 WP_001291435.1 NZ_CP103540:3446606-3446824 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255390 WP_000344800.1 NZ_CP103540:3446206-3446580 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |