Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 860323..860977 | Replicon | chromosome |
Accession | NZ_CP103540 | ||
Organism | Escherichia coli strain 5264 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | M5S66_RS04215 | Protein ID | WP_000244781.1 |
Coordinates | 860570..860977 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M5S66_RS04210 | Protein ID | WP_000354046.1 |
Coordinates | 860323..860589 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S66_RS04190 (856411) | 856411..857844 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
M5S66_RS04195 (857889) | 857889..858200 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
M5S66_RS04200 (858364) | 858364..859023 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
M5S66_RS04205 (859100) | 859100..860080 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
M5S66_RS04210 (860323) | 860323..860589 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M5S66_RS04215 (860570) | 860570..860977 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
M5S66_RS04220 (861017) | 861017..861538 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
M5S66_RS04225 (861650) | 861650..862546 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M5S66_RS04230 (862571) | 862571..863281 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5S66_RS04235 (863287) | 863287..865020 | + | 1734 | WP_021523238.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T255381 WP_000244781.1 NZ_CP103540:860570-860977 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|