Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3691382..3692217 Replicon chromosome
Accession NZ_CP103533
Organism Escherichia coli strain 4238

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag M5T38_RS17915 Protein ID WP_000854821.1
Coordinates 3691382..3691759 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M0D404
Locus tag M5T38_RS17920 Protein ID WP_024214935.1
Coordinates 3691849..3692217 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T38_RS17885 (3686934) 3686934..3687890 + 957 WP_000121355.1 molybdenum cofactor insertion chaperone PaoD -
M5T38_RS17890 (3687941) 3687941..3688279 + 339 Protein_3502 LysR substrate-binding domain-containing protein -
M5T38_RS17895 (3688618) 3688618..3689937 + 1320 WP_000144688.1 site-specific integrase -
M5T38_RS17900 (3690030) 3690030..3690878 - 849 WP_001280470.1 DUF4942 domain-containing protein -
M5T38_RS17905 (3690963) 3690963..3691160 - 198 WP_089075429.1 DUF957 domain-containing protein -
M5T38_RS17910 (3691188) 3691188..3691385 - 198 Protein_3506 DUF5983 family protein -
M5T38_RS17915 (3691382) 3691382..3691759 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5T38_RS17920 (3691849) 3691849..3692217 - 369 WP_024214935.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T38_RS17925 (3692297) 3692297..3692518 - 222 WP_000692350.1 DUF987 domain-containing protein -
M5T38_RS17930 (3692605) 3692605..3693081 - 477 WP_001186745.1 RadC family protein -
M5T38_RS17935 (3693097) 3693097..3693582 - 486 WP_204156951.1 antirestriction protein -
M5T38_RS17940 (3693674) 3693674..3694492 - 819 WP_001234397.1 DUF932 domain-containing protein -
M5T38_RS17945 (3694787) 3694787..3696328 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
M5T38_RS17950 (3696343) 3696343..3697089 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T255366 WP_000854821.1 NZ_CP103533:c3691759-3691382 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13605.41 Da        Isoelectric Point: 6.4659

>AT255366 WP_024214935.1 NZ_CP103533:c3692217-3691849 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0D404

References