Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1390991..1391616 | Replicon | chromosome |
| Accession | NZ_CP103533 | ||
| Organism | Escherichia coli strain 4238 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5T38_RS06810 | Protein ID | WP_000911330.1 |
| Coordinates | 1391218..1391616 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | M5T38_RS06805 | Protein ID | WP_000450524.1 |
| Coordinates | 1390991..1391218 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T38_RS06780 (1386794) | 1386794..1387264 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| M5T38_RS06785 (1387264) | 1387264..1387836 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| M5T38_RS06790 (1387982) | 1387982..1388860 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| M5T38_RS06795 (1388877) | 1388877..1389911 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| M5T38_RS06800 (1390124) | 1390124..1390837 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| M5T38_RS06805 (1390991) | 1390991..1391218 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| M5T38_RS06810 (1391218) | 1391218..1391616 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T38_RS06815 (1391763) | 1391763..1392626 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| M5T38_RS06820 (1392641) | 1392641..1394656 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| M5T38_RS06825 (1394730) | 1394730..1395428 | + | 699 | WP_000679823.1 | esterase | - |
| M5T38_RS06830 (1395538) | 1395538..1395738 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T255358 WP_000911330.1 NZ_CP103533:1391218-1391616 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|