Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 350724..351524 | Replicon | chromosome |
Accession | NZ_CP103533 | ||
Organism | Escherichia coli strain 4238 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | M5T38_RS01630 | Protein ID | WP_000342449.1 |
Coordinates | 350997..351524 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | M5T38_RS01625 | Protein ID | WP_001277108.1 |
Coordinates | 350724..350990 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T38_RS01605 (346381) | 346381..347049 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
M5T38_RS01610 (347042) | 347042..348100 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
M5T38_RS01615 (348345) | 348345..349199 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
M5T38_RS01620 (349471) | 349471..350574 | + | 1104 | WP_001350438.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
M5T38_RS01625 (350724) | 350724..350990 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
M5T38_RS01630 (350997) | 350997..351524 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
M5T38_RS01635 (351521) | 351521..351904 | - | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
M5T38_RS01640 (352328) | 352328..353437 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
M5T38_RS01645 (353485) | 353485..354411 | + | 927 | WP_000003004.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
M5T38_RS01650 (354408) | 354408..355685 | + | 1278 | WP_000803799.1 | branched chain amino acid ABC transporter permease LivM | - |
M5T38_RS01655 (355682) | 355682..356449 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T255352 WP_000342449.1 NZ_CP103533:350997-351524 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6GTS | |
PDB | 6AJN | |
PDB | 6GTQ | |
PDB | 6GTO | |
PDB | 6GTR | |
PDB | 6AJM | |
AlphaFold DB | A0A829CN24 |