Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 47541..48063 Replicon plasmid pMB9245_2
Accession NZ_CP103531
Organism Escherichia coli strain 5270

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M5T24_RS25160 Protein ID WP_000220560.1
Coordinates 47782..48063 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M5T24_RS25155 Protein ID WP_000121743.1
Coordinates 47541..47792 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T24_RS25120 (M5T24_25120) 42581..43278 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
M5T24_RS25125 (M5T24_25125) 43326..43580 + 255 WP_001354556.1 hypothetical protein -
M5T24_RS25130 (M5T24_25130) 44015..44314 + 300 WP_251569978.1 YcxB family protein -
M5T24_RS25135 (M5T24_25135) 44418..44609 + 192 WP_187564784.1 YcxB family protein -
M5T24_RS25140 (M5T24_25140) 44661..45017 - 357 WP_000876433.1 DNA distortion polypeptide 3 -
M5T24_RS25145 (M5T24_25145) 45154..45600 - 447 WP_001074388.1 hypothetical protein -
M5T24_RS25150 (M5T24_25150) 45625..46479 - 855 WP_001239324.1 replication initiation protein -
M5T24_RS25155 (M5T24_25155) 47541..47792 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M5T24_RS25160 (M5T24_25160) 47782..48063 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5T24_RS25165 (M5T24_25165) 48209..48532 + 324 WP_001181903.1 hypothetical protein -
M5T24_RS25170 (M5T24_25170) 48577..48822 + 246 WP_000360030.1 hypothetical protein -
M5T24_RS25175 (M5T24_25175) 48812..49027 + 216 WP_001180116.1 hypothetical protein -
M5T24_RS25180 (M5T24_25180) 49120..49449 + 330 WP_000866645.1 hypothetical protein -
M5T24_RS25185 (M5T24_25185) 49492..49671 + 180 WP_000439078.1 hypothetical protein -
M5T24_RS25190 (M5T24_25190) 49741..49890 + 150 WP_000003880.1 hypothetical protein -
M5T24_RS25195 (M5T24_25195) 49903..50175 + 273 WP_001354554.1 hypothetical protein -
M5T24_RS25200 (M5T24_25200) 50501..51046 + 546 WP_000757692.1 DNA distortion polypeptide 1 -
M5T24_RS25205 (M5T24_25205) 51049..52215 + 1167 WP_000539539.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / qnrS13 - 1..54200 54200


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T255350 WP_000220560.1 NZ_CP103531:47782-48063 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT255350 WP_000121743.1 NZ_CP103531:47541-47792 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References