Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 54736..55361 | Replicon | plasmid pMB9245_1 |
| Accession | NZ_CP103530 | ||
| Organism | Escherichia coli strain 5270 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1D7QA53 |
| Locus tag | M5T24_RS24455 | Protein ID | WP_039023147.1 |
| Coordinates | 54736..55134 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1D7QA08 |
| Locus tag | M5T24_RS24460 | Protein ID | WP_039023146.1 |
| Coordinates | 55134..55361 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T24_RS24440 (50980) | 50980..51477 | + | 498 | WP_000605862.1 | entry exclusion protein | - |
| M5T24_RS24445 (51509) | 51509..52240 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
| M5T24_RS24450 (52493) | 52493..54727 | + | 2235 | WP_062914766.1 | type IV conjugative transfer system coupling protein TraD | - |
| M5T24_RS24455 (54736) | 54736..55134 | - | 399 | WP_039023147.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T24_RS24460 (55134) | 55134..55361 | - | 228 | WP_039023146.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B / mph(A) | - | 1..133836 | 133836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14885.26 Da Isoelectric Point: 8.2824
>T255349 WP_039023147.1 NZ_CP103530:c55134-54736 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D7QA53 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D7QA08 |