Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3647963..3648581 | Replicon | chromosome |
| Accession | NZ_CP103529 | ||
| Organism | Escherichia coli strain 5270 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5T24_RS17565 | Protein ID | WP_001291435.1 |
| Coordinates | 3648363..3648581 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5T24_RS17560 | Protein ID | WP_000344800.1 |
| Coordinates | 3647963..3648337 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T24_RS17550 (3643052) | 3643052..3644245 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5T24_RS17555 (3644268) | 3644268..3647417 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| M5T24_RS17560 (3647963) | 3647963..3648337 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T24_RS17565 (3648363) | 3648363..3648581 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5T24_RS17570 (3648753) | 3648753..3649304 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| M5T24_RS17575 (3649420) | 3649420..3649890 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M5T24_RS17580 (3650054) | 3650054..3651604 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5T24_RS17585 (3651646) | 3651646..3651999 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M5T24_RS17595 (3652378) | 3652378..3652689 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| M5T24_RS17600 (3652720) | 3652720..3653292 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255340 WP_001291435.1 NZ_CP103529:3648363-3648581 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255340 WP_000344800.1 NZ_CP103529:3647963-3648337 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |