Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2613360..2613998 | Replicon | chromosome |
Accession | NZ_CP103529 | ||
Organism | Escherichia coli strain 5270 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M5T24_RS12535 | Protein ID | WP_001447010.1 |
Coordinates | 2613822..2613998 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5T24_RS12530 | Protein ID | WP_001270286.1 |
Coordinates | 2613360..2613776 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T24_RS12510 (2608512) | 2608512..2609453 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M5T24_RS12515 (2609454) | 2609454..2610467 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M5T24_RS12520 (2610485) | 2610485..2611630 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M5T24_RS12525 (2611875) | 2611875..2613281 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M5T24_RS12530 (2613360) | 2613360..2613776 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5T24_RS12535 (2613822) | 2613822..2613998 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5T24_RS12540 (2614220) | 2614220..2614450 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5T24_RS12545 (2614542) | 2614542..2616503 | - | 1962 | WP_259426000.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5T24_RS12550 (2616576) | 2616576..2617112 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M5T24_RS12555 (2617204) | 2617204..2618379 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T255339 WP_001447010.1 NZ_CP103529:c2613998-2613822 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255339 WP_001270286.1 NZ_CP103529:c2613776-2613360 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|