Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1947508..1948343 | Replicon | chromosome |
| Accession | NZ_CP103529 | ||
| Organism | Escherichia coli strain 5270 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1U9SHU4 |
| Locus tag | M5T24_RS09360 | Protein ID | WP_000854752.1 |
| Coordinates | 1947508..1947885 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | M5T24_RS09365 | Protein ID | WP_001278232.1 |
| Coordinates | 1947975..1948343 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T24_RS09325 (1943028) | 1943028..1943501 | + | 474 | WP_001105384.1 | DNA gyrase inhibitor SbmC | - |
| M5T24_RS09330 (1943699) | 1943699..1944757 | + | 1059 | WP_001200892.1 | FUSC family protein | - |
| M5T24_RS09335 (1944929) | 1944929..1945258 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| M5T24_RS09340 (1945359) | 1945359..1945724 | - | 366 | WP_223350516.1 | EutP/PduV family microcompartment system protein | - |
| M5T24_RS09345 (1945995) | 1945995..1946366 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| M5T24_RS09350 (1947182) | 1947182..1947262 | - | 81 | Protein_1831 | hypothetical protein | - |
| M5T24_RS09355 (1947362) | 1947362..1947511 | - | 150 | Protein_1832 | DUF5983 family protein | - |
| M5T24_RS09360 (1947508) | 1947508..1947885 | - | 378 | WP_000854752.1 | TA system toxin CbtA family protein | Toxin |
| M5T24_RS09365 (1947975) | 1947975..1948343 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M5T24_RS09370 (1948506) | 1948506..1948727 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T24_RS09375 (1948790) | 1948790..1949266 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M5T24_RS09380 (1949480) | 1949480..1951021 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| M5T24_RS09385 (1951036) | 1951036..1951782 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| M5T24_RS09390 (1951868) | 1951868..1952341 | - | 474 | WP_000855059.1 | antirestriction protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14076.08 Da Isoelectric Point: 8.2905
>T255333 WP_000854752.1 NZ_CP103529:c1947885-1947508 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT255333 WP_001278232.1 NZ_CP103529:c1948343-1947975 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1U9SHU4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |