Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 50516..51351 | Replicon | chromosome |
Accession | NZ_CP103529 | ||
Organism | Escherichia coli strain 5270 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M5T24_RS00260 | Protein ID | WP_001565141.1 |
Coordinates | 50516..50893 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | M5T24_RS00265 | Protein ID | WP_001565140.1 |
Coordinates | 50983..51351 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T24_RS00230 (45881) | 45881..46804 | - | 924 | WP_000535961.1 | carboxylate/amino acid/amine transporter | - |
M5T24_RS00235 (46915) | 46915..48099 | - | 1185 | WP_001172898.1 | sugar efflux transporter | - |
M5T24_RS00240 (48496) | 48496..48657 | - | 162 | Protein_47 | virulence RhuM family protein | - |
M5T24_RS00245 (48895) | 48895..49737 | - | 843 | WP_001565143.1 | DUF4942 domain-containing protein | - |
M5T24_RS00250 (49822) | 49822..50019 | - | 198 | WP_000839256.1 | DUF957 domain-containing protein | - |
M5T24_RS00255 (50031) | 50031..50519 | - | 489 | WP_001565142.1 | DUF5983 family protein | - |
M5T24_RS00260 (50516) | 50516..50893 | - | 378 | WP_001565141.1 | TA system toxin CbtA family protein | Toxin |
M5T24_RS00265 (50983) | 50983..51351 | - | 369 | WP_001565140.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T24_RS00270 (51426) | 51426..51647 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
M5T24_RS00275 (51716) | 51716..52192 | - | 477 | WP_001186771.1 | RadC family protein | - |
M5T24_RS00280 (52208) | 52208..52693 | - | 486 | WP_001737493.1 | antirestriction protein | - |
M5T24_RS00285 (52785) | 52785..53603 | - | 819 | WP_001234749.1 | DUF932 domain-containing protein | - |
M5T24_RS00290 (53694) | 53694..53927 | - | 234 | WP_001117560.1 | DUF905 family protein | - |
M5T24_RS00295 (53998) | 53998..55407 | - | 1410 | Protein_58 | autotransporter adhesin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14246.27 Da Isoelectric Point: 7.2920
>T255325 WP_001565141.1 NZ_CP103529:c50893-50516 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|