Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 74165..74808 | Replicon | plasmid pMB9272_2 |
Accession | NZ_CP103523 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | M5S63_RS25690 | Protein ID | WP_001044768.1 |
Coordinates | 74165..74581 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | M5S63_RS25695 | Protein ID | WP_001261287.1 |
Coordinates | 74578..74808 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS25675 (69469) | 69469..70401 | - | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
M5S63_RS25680 (70405) | 70405..71400 | - | 996 | WP_000246636.1 | hypothetical protein | - |
M5S63_RS25685 (71865) | 71865..74003 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
M5S63_RS25690 (74165) | 74165..74581 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S63_RS25695 (74578) | 74578..74808 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5S63_RS25700 (75115) | 75115..78234 | + | 3120 | WP_023909028.1 | hypothetical protein | - |
M5S63_RS25705 (78497) | 78497..79630 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / sul1 / qacE / aadA5 / tet(B) | - | 1..82867 | 82867 | |
- | flank | IS/Tn | - | - | 68829..69332 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T255323 WP_001044768.1 NZ_CP103523:c74581-74165 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |