Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 61575..62176 | Replicon | plasmid pMB9272_2 |
Accession | NZ_CP103523 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | M5S63_RS25645 | Protein ID | WP_001216034.1 |
Coordinates | 61575..61955 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | M5S63_RS25650 | Protein ID | WP_001190712.1 |
Coordinates | 61955..62176 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS25605 (56955) | 56955..57223 | + | 269 | Protein_73 | type II toxin-antitoxin system ParD family antitoxin | - |
M5S63_RS25610 (57210) | 57210..57499 | + | 290 | Protein_74 | type II toxin-antitoxin system RelE/ParE family toxin | - |
M5S63_RS25615 (57566) | 57566..57748 | + | 183 | WP_042065278.1 | hypothetical protein | - |
M5S63_RS25620 (57869) | 57869..58609 | + | 741 | WP_001066942.1 | tyrosine-type recombinase/integrase | - |
M5S63_RS25625 (58894) | 58894..59871 | - | 978 | WP_000361610.1 | RepB family plasmid replication initiator protein | - |
M5S63_RS25630 (60667) | 60667..61080 | - | 414 | Protein_78 | integrase core domain-containing protein | - |
M5S63_RS25635 (61085) | 61085..61363 | - | 279 | Protein_79 | pdcB | - |
M5S63_RS25640 (61391) | 61391..61570 | - | 180 | WP_001513661.1 | hypothetical protein | - |
M5S63_RS25645 (61575) | 61575..61955 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M5S63_RS25650 (61955) | 61955..62176 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5S63_RS25655 (62359) | 62359..63915 | + | 1557 | WP_001553856.1 | type I restriction-modification system subunit M | - |
M5S63_RS25660 (63912) | 63912..65183 | + | 1272 | WP_023142242.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / blaTEM-1B / sul1 / qacE / aadA5 / tet(B) | - | 1..82867 | 82867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T255322 WP_001216034.1 NZ_CP103523:c61955-61575 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |