Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4617789..4618624 | Replicon | chromosome |
Accession | NZ_CP103521 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J1YPH7 |
Locus tag | M5S63_RS22475 | Protein ID | WP_029701676.1 |
Coordinates | 4618247..4618624 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0K5N986 |
Locus tag | M5S63_RS22470 | Protein ID | WP_021553056.1 |
Coordinates | 4617789..4618157 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS22435 (4613451) | 4613451..4614131 | + | 681 | WP_029702103.1 | WYL domain-containing protein | - |
M5S63_RS22440 (4614279) | 4614279..4614956 | + | 678 | WP_001097302.1 | hypothetical protein | - |
M5S63_RS22445 (4614962) | 4614962..4615195 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
M5S63_RS22450 (4615285) | 4615285..4616103 | + | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
M5S63_RS22455 (4616369) | 4616369..4616848 | + | 480 | WP_001564060.1 | antirestriction protein | - |
M5S63_RS22460 (4616864) | 4616864..4617340 | + | 477 | WP_021553055.1 | RadC family protein | - |
M5S63_RS22465 (4617405) | 4617405..4617626 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
M5S63_RS22470 (4617789) | 4617789..4618157 | + | 369 | WP_021553056.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5S63_RS22475 (4618247) | 4618247..4618624 | + | 378 | WP_029701676.1 | TA system toxin CbtA family protein | Toxin |
M5S63_RS22480 (4618621) | 4618621..4618770 | + | 150 | Protein_4400 | DUF5983 family protein | - |
M5S63_RS22485 (4618849) | 4618849..4619043 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
M5S63_RS22490 (4619128) | 4619128..4619970 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
M5S63_RS22495 (4620719) | 4620719..4622257 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4584269..4630069 | 45800 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14066.04 Da Isoelectric Point: 7.8045
>T255311 WP_029701676.1 NZ_CP103521:4618247-4618624 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13615.39 Da Isoelectric Point: 7.0264
>AT255311 WP_021553056.1 NZ_CP103521:4617789-4618157 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1YPH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K5N986 |