Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4346324..4347138 | Replicon | chromosome |
Accession | NZ_CP103521 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M5S63_RS21030 | Protein ID | WP_001054376.1 |
Coordinates | 4346324..4346581 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | M5S63_RS21035 | Protein ID | WP_001309181.1 |
Coordinates | 4346593..4347138 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS21005 (4341612) | 4341612..4342718 | + | 1107 | WP_204638466.1 | N-acetylneuraminate epimerase | - |
M5S63_RS21010 (4342783) | 4342783..4343763 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M5S63_RS21015 (4343873) | 4343873..4344078 | + | 206 | Protein_4112 | HNH endonuclease | - |
M5S63_RS21020 (4344346) | 4344346..4345586 | - | 1241 | Protein_4113 | helicase YjhR | - |
M5S63_RS21025 (4345702) | 4345702..4345833 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M5S63_RS21030 (4346324) | 4346324..4346581 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M5S63_RS21035 (4346593) | 4346593..4347138 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
M5S63_RS21040 (4347194) | 4347194..4347940 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M5S63_RS21045 (4348109) | 4348109..4348327 | + | 219 | Protein_4118 | hypothetical protein | - |
M5S63_RS21050 (4348365) | 4348365..4348481 | + | 117 | Protein_4119 | VOC family protein | - |
M5S63_RS21055 (4348726) | 4348726..4349847 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M5S63_RS21060 (4349844) | 4349844..4350122 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M5S63_RS21065 (4350134) | 4350134..4351447 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4338818..4355362 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T255308 WP_001054376.1 NZ_CP103521:4346324-4346581 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT255308 WP_001309181.1 NZ_CP103521:4346593-4347138 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|