Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2591322..2591960 | Replicon | chromosome |
Accession | NZ_CP103521 | ||
Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0D8WF76 |
Locus tag | M5S63_RS12605 | Protein ID | WP_001306887.1 |
Coordinates | 2591784..2591960 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5S63_RS12600 | Protein ID | WP_001270286.1 |
Coordinates | 2591322..2591738 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S63_RS12580 (2586474) | 2586474..2587415 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
M5S63_RS12585 (2587416) | 2587416..2588429 | - | 1014 | WP_001523231.1 | ABC transporter ATP-binding protein | - |
M5S63_RS12590 (2588447) | 2588447..2589592 | - | 1146 | WP_020233879.1 | ABC transporter substrate-binding protein | - |
M5S63_RS12595 (2589837) | 2589837..2591243 | - | 1407 | WP_001523229.1 | PLP-dependent aminotransferase family protein | - |
M5S63_RS12600 (2591322) | 2591322..2591738 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5S63_RS12605 (2591784) | 2591784..2591960 | - | 177 | WP_001306887.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5S63_RS12610 (2592182) | 2592182..2592412 | + | 231 | WP_000494241.1 | YncJ family protein | - |
M5S63_RS12615 (2592504) | 2592504..2594465 | - | 1962 | WP_024166512.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5S63_RS12620 (2594538) | 2594538..2595074 | - | 537 | WP_020233877.1 | DNA-binding transcriptional regulator SutR | - |
M5S63_RS12625 (2595166) | 2595166..2596338 | + | 1173 | WP_001523225.1 | BenE family transporter YdcO | - |
M5S63_RS12630 (2596446) | 2596446..2596904 | - | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2596446..2596904 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6768.88 Da Isoelectric Point: 11.5336
>T255302 WP_001306887.1 NZ_CP103521:c2591960-2591784 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255302 WP_001270286.1 NZ_CP103521:c2591738-2591322 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|