Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hipBA/HipA-HipB |
| Location | 2488551..2489512 | Replicon | chromosome |
| Accession | NZ_CP103521 | ||
| Organism | Escherichia coli strain 2779 - blood draw same patient as MB9267 | ||
Toxin (Protein)
| Gene name | hipA | Uniprot ID | A0A1Q5ZNB7 |
| Locus tag | M5S63_RS12160 | Protein ID | WP_021523084.1 |
| Coordinates | 2488817..2489512 (+) | Length | 232 a.a. |
Antitoxin (Protein)
| Gene name | hipB | Uniprot ID | - |
| Locus tag | M5S63_RS12155 | Protein ID | WP_001296726.1 |
| Coordinates | 2488551..2488817 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S63_RS12155 (2488551) | 2488551..2488817 | + | 267 | WP_001296726.1 | type II toxin-antitoxin system antitoxin HipB | Antitoxin |
| M5S63_RS12160 (2488817) | 2488817..2489512 | + | 696 | WP_021523084.1 | HipA N-terminal domain-containing protein | Toxin |
| M5S63_RS12165 (2489712) | 2489712..2491064 | - | 1353 | WP_001551127.1 | SIR2 family protein | - |
| M5S63_RS12170 (2491279) | 2491279..2492311 | - | 1033 | Protein_2382 | ISNCY family transposase | - |
| M5S63_RS12175 (2492678) | 2492678..2493577 | - | 900 | WP_001523294.1 | LysR family transcriptional regulator | - |
| M5S63_RS12180 (2493716) | 2493716..2494024 | + | 309 | WP_001221046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2491279..2492097 | 818 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 232 a.a. Molecular weight: 25773.79 Da Isoelectric Point: 9.9928
>T255301 WP_021523084.1 NZ_CP103521:2488817-2489512 [Escherichia coli]
MPKLVTWMNNQRVGELTKLANGAHTFKYAPEWLANRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPIVRDRIVKRYH
AKSRQPFDLLSEIGRDSVGAVTLIPEDETIQAGGSYRLTPFYDIISAFPVLGGAGIHISDLKLAMGVNASKGKKTAIDKI
YPRHFLATAKVLKFPEVQMHEILSDFARMIPAALDNVKTSLPTDFPENVVTAVETNVLRLHGRLSREYGIK
MPKLVTWMNNQRVGELTKLANGAHTFKYAPEWLANRYARPLSLSLPLQRGNITSDAVFNFFDNLLPDSPIVRDRIVKRYH
AKSRQPFDLLSEIGRDSVGAVTLIPEDETIQAGGSYRLTPFYDIISAFPVLGGAGIHISDLKLAMGVNASKGKKTAIDKI
YPRHFLATAKVLKFPEVQMHEILSDFARMIPAALDNVKTSLPTDFPENVVTAVETNVLRLHGRLSREYGIK
Download Length: 696 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|