Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1321762..1322387 | Replicon | chromosome |
Accession | NZ_CP103515 | ||
Organism | Escherichia coli strain 5444 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | M5S96_RS06405 | Protein ID | WP_000911329.1 |
Coordinates | 1321989..1322387 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | M5S96_RS06400 | Protein ID | WP_000450524.1 |
Coordinates | 1321762..1321989 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S96_RS06375 (1317563) | 1317563..1318033 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
M5S96_RS06380 (1318033) | 1318033..1318605 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
M5S96_RS06385 (1318751) | 1318751..1319629 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M5S96_RS06390 (1319646) | 1319646..1320680 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
M5S96_RS06395 (1320893) | 1320893..1321606 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
M5S96_RS06400 (1321762) | 1321762..1321989 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M5S96_RS06405 (1321989) | 1321989..1322387 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S96_RS06410 (1322534) | 1322534..1323397 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
M5S96_RS06415 (1323412) | 1323412..1325427 | + | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
M5S96_RS06420 (1325501) | 1325501..1326199 | + | 699 | WP_000679812.1 | esterase | - |
M5S96_RS06425 (1326309) | 1326309..1326509 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T255264 WP_000911329.1 NZ_CP103515:1321989-1322387 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |