Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 154950..155620 Replicon plasmid pMB9306_1
Accession NZ_CP103513
Organism Klebsiella pneumoniae strain 5531

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M5S57_RS27205 Protein ID WP_004213072.1
Coordinates 154950..155393 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M5S57_RS27210 Protein ID WP_004213073.1
Coordinates 155390..155620 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S57_RS27170 (M5S57_27170) 150358..150633 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
M5S57_RS27175 (M5S57_27175) 150696..151187 + 492 WP_011251327.1 DM13 domain-containing protein -
M5S57_RS27180 (M5S57_27180) 151236..152156 + 921 WP_004213934.1 DUF1471 domain-containing protein -
M5S57_RS27185 (M5S57_27185) 152247..152650 + 404 Protein_166 GAF domain-containing protein -
M5S57_RS27190 (M5S57_27190) 153168..153806 - 639 Protein_167 mucoid phenotype regulator RmpA2 -
M5S57_RS27195 (M5S57_27195) 154223..154527 + 305 Protein_168 transposase -
M5S57_RS27200 (M5S57_27200) 154550..154801 - 252 WP_186987481.1 hypothetical protein -
M5S57_RS27205 (M5S57_27205) 154950..155393 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M5S57_RS27210 (M5S57_27210) 155390..155620 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5S57_RS27215 (M5S57_27215) 156228..157361 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
M5S57_RS27220 (M5S57_27220) 157377..157670 + 294 WP_004213076.1 hypothetical protein -
M5S57_RS27225 (M5S57_27225) 157660..157866 - 207 WP_004213077.1 hypothetical protein -
M5S57_RS27230 (M5S57_27230) 158218..158508 + 291 WP_004213078.1 hypothetical protein -
M5S57_RS27235 (M5S57_27235) 158498..159397 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..230429 230429


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T255259 WP_004213072.1 NZ_CP103513:c155393-154950 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT255259 WP_004213073.1 NZ_CP103513:c155620-155390 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References