Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 154950..155620 | Replicon | plasmid pMB9306_1 |
| Accession | NZ_CP103513 | ||
| Organism | Klebsiella pneumoniae strain 5531 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | M5S57_RS27205 | Protein ID | WP_004213072.1 |
| Coordinates | 154950..155393 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | M5S57_RS27210 | Protein ID | WP_004213073.1 |
| Coordinates | 155390..155620 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S57_RS27170 (M5S57_27170) | 150358..150633 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| M5S57_RS27175 (M5S57_27175) | 150696..151187 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| M5S57_RS27180 (M5S57_27180) | 151236..152156 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| M5S57_RS27185 (M5S57_27185) | 152247..152650 | + | 404 | Protein_166 | GAF domain-containing protein | - |
| M5S57_RS27190 (M5S57_27190) | 153168..153806 | - | 639 | Protein_167 | mucoid phenotype regulator RmpA2 | - |
| M5S57_RS27195 (M5S57_27195) | 154223..154527 | + | 305 | Protein_168 | transposase | - |
| M5S57_RS27200 (M5S57_27200) | 154550..154801 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| M5S57_RS27205 (M5S57_27205) | 154950..155393 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S57_RS27210 (M5S57_27210) | 155390..155620 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5S57_RS27215 (M5S57_27215) | 156228..157361 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| M5S57_RS27220 (M5S57_27220) | 157377..157670 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| M5S57_RS27225 (M5S57_27225) | 157660..157866 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| M5S57_RS27230 (M5S57_27230) | 158218..158508 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| M5S57_RS27235 (M5S57_27235) | 158498..159397 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..230429 | 230429 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T255259 WP_004213072.1 NZ_CP103513:c155393-154950 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|