Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 102327..103237 Replicon plasmid pMB9306_1
Accession NZ_CP103513
Organism Klebsiella pneumoniae strain 5531

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag M5S57_RS26905 Protein ID WP_004026354.1
Coordinates 102327..102797 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag M5S57_RS26910 Protein ID WP_004026357.1
Coordinates 102794..103237 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S57_RS26880 (M5S57_26880) 97739..98137 - 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -
M5S57_RS26885 (M5S57_26885) 98474..98968 - 495 WP_004212794.1 thermonuclease family protein -
M5S57_RS26890 (M5S57_26890) 99146..99412 + 267 WP_223175074.1 DUF1173 family protein -
M5S57_RS26895 (M5S57_26895) 99403..100095 + 693 WP_011154578.1 DUF1173 family protein -
M5S57_RS26905 (M5S57_26905) 102327..102797 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
M5S57_RS26910 (M5S57_26910) 102794..103237 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
M5S57_RS26915 (M5S57_26915) 103338..103841 - 504 Protein_112 DUF4113 domain-containing protein -
M5S57_RS26920 (M5S57_26920) 103939..104160 - 222 WP_004213643.1 DUF2188 domain-containing protein -
M5S57_RS26925 (M5S57_26925) 104341..104460 - 120 Protein_114 Fe3+-citrate ABC transporter substrate-binding protein -
M5S57_RS26930 (M5S57_26930) 104535..106661 - 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
M5S57_RS26935 (M5S57_26935) 106748..107701 - 954 Protein_116 fec operon regulator FecR -
M5S57_RS26940 (M5S57_26940) 107698..108219 - 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..230429 230429
- flank IS/Tn - - 101481..101984 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T255258 WP_004026354.1 NZ_CP103513:c102797-102327 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT255258 WP_004026357.1 NZ_CP103513:c103237-102794 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References