Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5382118..5382743 | Replicon | chromosome |
| Accession | NZ_CP103512 | ||
| Organism | Klebsiella pneumoniae strain 5531 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A330XB05 |
| Locus tag | M5S57_RS25990 | Protein ID | WP_012737091.1 |
| Coordinates | 5382118..5382501 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M5S57_RS25995 | Protein ID | WP_004150355.1 |
| Coordinates | 5382501..5382743 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S57_RS25975 (5379484) | 5379484..5380386 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M5S57_RS25980 (5380383) | 5380383..5381018 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5S57_RS25985 (5381015) | 5381015..5381944 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M5S57_RS25990 (5382118) | 5382118..5382501 | - | 384 | WP_012737091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5S57_RS25995 (5382501) | 5382501..5382743 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M5S57_RS26000 (5382948) | 5382948..5383865 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| M5S57_RS26005 (5383879) | 5383879..5384820 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M5S57_RS26010 (5384865) | 5384865..5385302 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M5S57_RS26015 (5385299) | 5385299..5386159 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M5S57_RS26020 (5386153) | 5386153..5386752 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14266.53 Da Isoelectric Point: 7.2771
>T255256 WP_012737091.1 NZ_CP103512:c5382501-5382118 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRCEAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKGFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330XB05 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |