Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4912192..4912708 | Replicon | chromosome |
Accession | NZ_CP103512 | ||
Organism | Klebsiella pneumoniae strain 5531 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5S57_RS23745 | Protein ID | WP_004178374.1 |
Coordinates | 4912192..4912476 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5S57_RS23750 | Protein ID | WP_002886901.1 |
Coordinates | 4912466..4912708 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S57_RS23720 (4907588) | 4907588..4907851 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
M5S57_RS23725 (4907981) | 4907981..4908154 | + | 174 | WP_041169004.1 | hypothetical protein | - |
M5S57_RS23730 (4908157) | 4908157..4908900 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5S57_RS23735 (4909257) | 4909257..4911395 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5S57_RS23740 (4911724) | 4911724..4912188 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5S57_RS23745 (4912192) | 4912192..4912476 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S57_RS23750 (4912466) | 4912466..4912708 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5S57_RS23755 (4912786) | 4912786..4914696 | - | 1911 | WP_012737231.1 | PRD domain-containing protein | - |
M5S57_RS23760 (4914719) | 4914719..4915873 | - | 1155 | WP_012737230.1 | lactonase family protein | - |
M5S57_RS23765 (4915940) | 4915940..4916680 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255255 WP_004178374.1 NZ_CP103512:c4912476-4912192 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |