Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4152892..4153511 Replicon chromosome
Accession NZ_CP103512
Organism Klebsiella pneumoniae strain 5531

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S57_RS20165 Protein ID WP_002892050.1
Coordinates 4153293..4153511 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S57_RS20160 Protein ID WP_002892066.1
Coordinates 4152892..4153266 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S57_RS20150 (4148044) 4148044..4149237 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S57_RS20155 (4149260) 4149260..4152406 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5S57_RS20160 (4152892) 4152892..4153266 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S57_RS20165 (4153293) 4153293..4153511 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S57_RS20170 (4153670) 4153670..4154236 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S57_RS20175 (4154208) 4154208..4154348 - 141 WP_004147370.1 hypothetical protein -
M5S57_RS20180 (4154369) 4154369..4154839 + 471 WP_002892026.1 YlaC family protein -
M5S57_RS20185 (4154814) 4154814..4156265 - 1452 WP_014907971.1 PLP-dependent aminotransferase family protein -
M5S57_RS20190 (4156366) 4156366..4157064 + 699 WP_002892021.1 GNAT family protein -
M5S57_RS20195 (4157061) 4157061..4157201 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5S57_RS20200 (4157201) 4157201..4157464 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255253 WP_002892050.1 NZ_CP103512:4153293-4153511 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255253 WP_002892066.1 NZ_CP103512:4152892-4153266 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References