Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 51624..52225 Replicon plasmid pMB9366_2
Accession NZ_CP103510
Organism Escherichia coli O25b:H4-ST131 strain 5506

Toxin (Protein)


Gene name doc Uniprot ID Q47172
Locus tag M5T03_RS25410 Protein ID WP_001694510.1
Coordinates 51624..52004 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5T03_RS25415 Protein ID WP_001190712.1
Coordinates 52004..52225 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T03_RS25385 (M5T03_25385) 47065..48549 - 1485 WP_083580905.1 terminase -
M5T03_RS25390 (M5T03_25390) 48549..49742 - 1194 WP_000219625.1 hypothetical protein -
M5T03_RS25395 (M5T03_25395) 49828..50280 - 453 WP_001326849.1 late promoter-activating protein -
M5T03_RS25400 (M5T03_25400) 50369..51412 - 1044 WP_023356283.1 DUF968 domain-containing protein -
M5T03_RS25405 (M5T03_25405) 51440..51619 - 180 WP_078182672.1 PdcA protein -
M5T03_RS25410 (M5T03_25410) 51624..52004 - 381 WP_001694510.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T03_RS25415 (M5T03_25415) 52004..52225 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T03_RS25420 (M5T03_25420) 52408..52611 + 204 Protein_48 type I restriction-modification system subunit M N-terminal domain-containing protein -
M5T03_RS25425 (M5T03_25425) 52671..53368 + 698 WP_223364191.1 IS1-like element IS1A family transposase -
M5T03_RS25430 (M5T03_25430) 53375..53812 + 438 Protein_50 hypothetical protein -
M5T03_RS25435 (M5T03_25435) 53802..54242 + 441 WP_000786815.1 heat resistance system thioredoxin Trx-GI -
M5T03_RS25440 (M5T03_25440) 54246..55955 + 1710 WP_023326110.1 heat resistance system K+/H+ antiporter KefB-GI -
M5T03_RS25445 (M5T03_25445) 55958..56455 + 498 WP_001514138.1 heat resistance protein PsiE-GI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..63298 63298


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13616.35 Da        Isoelectric Point: 5.1514

>T255244 WP_001694510.1 NZ_CP103510:c52004-51624 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT255244 WP_001190712.1 NZ_CP103510:c52225-52004 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A737M8C8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References