Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 105525..106050 | Replicon | plasmid pMB9366_1 |
| Accession | NZ_CP103509 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | M5T03_RS25145 | Protein ID | WP_001159868.1 |
| Coordinates | 105525..105830 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | M5T03_RS25150 | Protein ID | WP_000813634.1 |
| Coordinates | 105832..106050 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS25130 (101435) | 101435..102601 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| M5T03_RS25135 (103189) | 103189..103944 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| M5T03_RS25140 (104718) | 104718..105524 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| M5T03_RS25145 (105525) | 105525..105830 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M5T03_RS25150 (105832) | 105832..106050 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M5T03_RS25155 (106758) | 106758..107753 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| M5T03_RS25160 (107796) | 107796..108410 | + | 615 | WP_259425960.1 | S-4TM family putative pore-forming effector | - |
| M5T03_RS25170 (109249) | 109249..109407 | + | 159 | WP_228955855.1 | abortive infection family protein | - |
| M5T03_RS25175 (109566) | 109566..110537 | - | 972 | Protein_133 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-52B | senB | 1..111292 | 111292 | |
| - | flank | IS/Tn | - | - | 108404..108907 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T255243 WP_001159868.1 NZ_CP103509:c105830-105525 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|