Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4242163..4242998 | Replicon | chromosome |
| Accession | NZ_CP103508 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5T03_RS20875 | Protein ID | WP_000854759.1 |
| Coordinates | 4242163..4242540 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5T03_RS20880 | Protein ID | WP_001295723.1 |
| Coordinates | 4242630..4242998 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS20850 (4238274) | 4238274..4239896 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| M5T03_RS20855 (4240687) | 4240687..4240863 | - | 177 | Protein_4089 | helix-turn-helix domain-containing protein | - |
| M5T03_RS20860 (4241230) | 4241230..4241379 | - | 150 | Protein_4090 | hypothetical protein | - |
| M5T03_RS20865 (4241485) | 4241485..4241661 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5T03_RS20870 (4241678) | 4241678..4242166 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5T03_RS20875 (4242163) | 4242163..4242540 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5T03_RS20880 (4242630) | 4242630..4242998 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T03_RS20885 (4243161) | 4243161..4243382 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5T03_RS20890 (4243445) | 4243445..4243921 | - | 477 | WP_001186775.1 | RadC family protein | - |
| M5T03_RS20895 (4243937) | 4243937..4244410 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| M5T03_RS20900 (4244752) | 4244752..4245570 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| M5T03_RS20905 (4245688) | 4245688..4245883 | - | 196 | Protein_4099 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4230517..4257192 | 26675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T255232 WP_000854759.1 NZ_CP103508:c4242540-4242163 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255232 WP_001295723.1 NZ_CP103508:c4242998-4242630 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |