Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4048769..4049289 Replicon chromosome
Accession NZ_CP103508
Organism Escherichia coli O25b:H4-ST131 strain 5506

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag M5T03_RS19945 Protein ID WP_001160964.1
Coordinates 4048769..4049053 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M5T03_RS19950 Protein ID WP_000125566.1
Coordinates 4049056..4049289 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T03_RS19920 (4044414) 4044414..4045700 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5T03_RS19925 (4045700) 4045700..4046689 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5T03_RS19930 (4046686) 4046686..4047507 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5T03_RS19935 (4047510) 4047510..4047887 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5T03_RS19940 (4047894) 4047894..4048742 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5T03_RS19945 (4048769) 4048769..4049053 - 285 WP_001160964.1 CcdB family protein Toxin
M5T03_RS19950 (4049056) 4049056..4049289 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5T03_RS19955 (4049375) 4049375..4049854 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5T03_RS19960 (4050046) 4050046..4051908 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
M5T03_RS19965 (4051901) 4051901..4052431 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5T03_RS19970 (4052539) 4052539..4053870 - 1332 WP_001183209.1 MFS transporter -
M5T03_RS19975 (4053929) 4053929..4054216 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T255230 WP_001160964.1 NZ_CP103508:c4049053-4048769 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT255230 WP_000125566.1 NZ_CP103508:c4049289-4049056 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References