Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3597856..3598474 | Replicon | chromosome |
| Accession | NZ_CP103508 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5T03_RS17795 | Protein ID | WP_001291435.1 |
| Coordinates | 3598256..3598474 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5T03_RS17790 | Protein ID | WP_000344800.1 |
| Coordinates | 3597856..3598230 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS17780 (3592945) | 3592945..3594138 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5T03_RS17785 (3594161) | 3594161..3597310 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| M5T03_RS17790 (3597856) | 3597856..3598230 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T03_RS17795 (3598256) | 3598256..3598474 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5T03_RS17800 (3598648) | 3598648..3599199 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| M5T03_RS17805 (3599315) | 3599315..3599785 | + | 471 | WP_259425935.1 | YlaC family protein | - |
| M5T03_RS17810 (3599949) | 3599949..3601499 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5T03_RS17815 (3601541) | 3601541..3601894 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| M5T03_RS17825 (3602273) | 3602273..3602584 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| M5T03_RS17830 (3602615) | 3602615..3603187 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255228 WP_001291435.1 NZ_CP103508:3598256-3598474 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255228 WP_000344800.1 NZ_CP103508:3597856-3598230 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |