Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1862964..1863795 Replicon chromosome
Accession NZ_CP103508
Organism Escherichia coli O25b:H4-ST131 strain 5506

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M5T03_RS08835 Protein ID WP_000854815.1
Coordinates 1862964..1863338 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag M5T03_RS08840 Protein ID WP_001280918.1
Coordinates 1863427..1863795 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T03_RS08795 (1858360) 1858360..1859526 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5T03_RS08800 (1859645) 1859645..1860118 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
M5T03_RS08805 (1860316) 1860316..1861374 + 1059 WP_001200889.1 FUSC family protein -
M5T03_RS08810 (1861546) 1861546..1861875 + 330 WP_000450409.1 DUF496 family protein -
M5T03_RS08815 (1861976) 1861976..1862299 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
M5T03_RS08820 (1862278) 1862278..1862358 + 81 WP_023441679.1 hypothetical protein -
M5T03_RS08825 (1862647) 1862647..1862727 - 81 Protein_1727 hypothetical protein -
M5T03_RS08830 (1862773) 1862773..1862967 - 195 WP_000988600.1 DUF5983 family protein -
M5T03_RS08835 (1862964) 1862964..1863338 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5T03_RS08840 (1863427) 1863427..1863795 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T03_RS08845 (1863811) 1863811..1864455 - 645 WP_000086752.1 hypothetical protein -
M5T03_RS08850 (1864474) 1864474..1864695 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5T03_RS08855 (1864758) 1864758..1865234 - 477 WP_001186200.1 RadC family protein -
M5T03_RS08860 (1865250) 1865250..1865723 - 474 WP_001542276.1 antirestriction protein -
M5T03_RS08865 (1865817) 1865817..1866062 - 246 WP_001164966.1 hypothetical protein -
M5T03_RS08870 (1866062) 1866062..1866880 - 819 WP_001542275.1 DUF932 domain-containing protein -
M5T03_RS08875 (1867101) 1867101..1867511 - 411 WP_000846703.1 hypothetical protein -
M5T03_RS08880 (1867527) 1867527..1867877 - 351 Protein_1738 hypothetical protein -
M5T03_RS08885 (1867960) 1867960..1868706 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T255221 WP_000854815.1 NZ_CP103508:c1863338-1862964 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT255221 WP_001280918.1 NZ_CP103508:c1863795-1863427 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References