Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 783149..783983 | Replicon | chromosome |
| Accession | NZ_CP103508 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5506 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M5T03_RS03860 | Protein ID | WP_000854690.1 |
| Coordinates | 783149..783526 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M5T03_RS03865 | Protein ID | WP_001305076.1 |
| Coordinates | 783615..783983 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T03_RS03830 (779543) | 779543..779713 | - | 171 | Protein_752 | IS110 family transposase | - |
| M5T03_RS03835 (780130) | 780130..781063 | - | 934 | Protein_753 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M5T03_RS03840 (781056) | 781056..781451 | - | 396 | WP_000208384.1 | DUF6088 family protein | - |
| M5T03_RS03845 (781520) | 781520..782365 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M5T03_RS03850 (782450) | 782450..782647 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M5T03_RS03855 (782664) | 782664..783152 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M5T03_RS03860 (783149) | 783149..783526 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M5T03_RS03865 (783615) | 783615..783983 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T03_RS03870 (784033) | 784033..784677 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M5T03_RS03875 (784696) | 784696..784917 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M5T03_RS03880 (784980) | 784980..785456 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M5T03_RS03885 (785472) | 785472..785957 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M5T03_RS03890 (786012) | 786012..786830 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M5T03_RS03895 (786931) | 786931..787164 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M5T03_RS03900 (787243) | 787243..787698 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M5T03_RS03905 (787774) | 787774..788901 | - | 1128 | Protein_767 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T255218 WP_000854690.1 NZ_CP103508:c783526-783149 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT255218 WP_001305076.1 NZ_CP103508:c783983-783615 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|