Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 202703..203454 | Replicon | plasmid pMB9481_1 |
| Accession | NZ_CP103504 | ||
| Organism | Klebsiella pneumoniae strain 5547 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | M5R16_RS27225 | Protein ID | WP_014386536.1 |
| Coordinates | 202703..203185 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | M5R16_RS27230 | Protein ID | WP_004902250.1 |
| Coordinates | 203176..203454 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R16_RS27200 (M5R16_27200) | 198092..198484 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| M5R16_RS27205 (M5R16_27205) | 198589..199128 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| M5R16_RS27210 (M5R16_27210) | 199965..200390 | + | 426 | WP_000422741.1 | transposase | - |
| M5R16_RS27215 (M5R16_27215) | 200387..200737 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5R16_RS27220 (M5R16_27220) | 200768..202381 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| M5R16_RS27225 (M5R16_27225) | 202703..203185 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| M5R16_RS27230 (M5R16_27230) | 203176..203454 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| M5R16_RS27235 (M5R16_27235) | 203573..203785 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| M5R16_RS27240 (M5R16_27240) | 203893..204234 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| M5R16_RS27245 (M5R16_27245) | 205064..205522 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| M5R16_RS27250 (M5R16_27250) | 206175..206630 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| M5R16_RS27255 (M5R16_27255) | 206702..207067 | + | 366 | WP_004200999.1 | mercuric ion transporter MerT | - |
| M5R16_RS27260 (M5R16_27260) | 207083..207358 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
| M5R16_RS27265 (M5R16_27265) | 207386..207811 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaNDM-1 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..235473 | 235473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T255209 WP_014386536.1 NZ_CP103504:c203185-202703 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |