Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/ElaA-DUF1778
Location 202703..203454 Replicon plasmid pMB9481_1
Accession NZ_CP103504
Organism Klebsiella pneumoniae strain 5547

Toxin (Protein)


Gene name ataT Uniprot ID H6U1U8
Locus tag M5R16_RS27225 Protein ID WP_014386536.1
Coordinates 202703..203185 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A071LPN3
Locus tag M5R16_RS27230 Protein ID WP_004902250.1
Coordinates 203176..203454 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R16_RS27200 (M5R16_27200) 198092..198484 - 393 WP_032442757.1 hypothetical protein -
M5R16_RS27205 (M5R16_27205) 198589..199128 - 540 WP_004902239.1 hypothetical protein -
M5R16_RS27210 (M5R16_27210) 199965..200390 + 426 WP_000422741.1 transposase -
M5R16_RS27215 (M5R16_27215) 200387..200737 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
M5R16_RS27220 (M5R16_27220) 200768..202381 + 1614 WP_000080200.1 IS66-like element ISEc23 family transposase -
M5R16_RS27225 (M5R16_27225) 202703..203185 - 483 WP_014386536.1 GNAT family N-acetyltransferase Toxin
M5R16_RS27230 (M5R16_27230) 203176..203454 - 279 WP_004902250.1 DUF1778 domain-containing protein Antitoxin
M5R16_RS27235 (M5R16_27235) 203573..203785 - 213 WP_004902255.1 hypothetical protein -
M5R16_RS27240 (M5R16_27240) 203893..204234 - 342 WP_004902257.1 hypothetical protein -
M5R16_RS27245 (M5R16_27245) 205064..205522 - 459 WP_014386535.1 hypothetical protein -
M5R16_RS27250 (M5R16_27250) 206175..206630 - 456 WP_001166628.1 Hg(II)-responsive transcriptional regulator -
M5R16_RS27255 (M5R16_27255) 206702..207067 + 366 WP_004200999.1 mercuric ion transporter MerT -
M5R16_RS27260 (M5R16_27260) 207083..207358 + 276 WP_000732275.1 mercury resistance system periplasmic binding protein MerP -
M5R16_RS27265 (M5R16_27265) 207386..207811 + 426 WP_000522996.1 organomercurial transporter MerC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaNDM-1 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 - 1..235473 235473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(42-144)

Antitoxin

Vibrio phage ICP1, Orf50

(10-86)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17662.45 Da        Isoelectric Point: 8.9130

>T255209 WP_014386536.1 NZ_CP103504:c203185-202703 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV

Download         Length: 483 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10704.23 Da        Isoelectric Point: 4.5271

>AT255209 WP_004902250.1 NZ_CP103504:c203454-203176 [Klebsiella pneumoniae]
MKPDVREAPINIRAKTSQRDLIDMAASLVSKSRTDFMLEVACREAQDILLDQRLFLLNDNQFEAFIEELDAPITPERQAR
IDNLMNRKSPWE

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MBI1

Antitoxin

Source ID Structure
AlphaFold DB A0A071LPN3

References