Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4789009..4789525 | Replicon | chromosome |
Accession | NZ_CP103503 | ||
Organism | Klebsiella pneumoniae strain 5547 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5R16_RS23485 | Protein ID | WP_004178374.1 |
Coordinates | 4789009..4789293 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5R16_RS23490 | Protein ID | WP_002886901.1 |
Coordinates | 4789283..4789525 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R16_RS23460 (4784493) | 4784493..4784756 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
M5R16_RS23465 (4784886) | 4784886..4785059 | + | 174 | WP_032408826.1 | hypothetical protein | - |
M5R16_RS23470 (4785062) | 4785062..4785805 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5R16_RS23475 (4786162) | 4786162..4788300 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5R16_RS23480 (4788541) | 4788541..4789005 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5R16_RS23485 (4789009) | 4789009..4789293 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R16_RS23490 (4789283) | 4789283..4789525 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5R16_RS23495 (4789603) | 4789603..4791513 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
M5R16_RS23500 (4791536) | 4791536..4792690 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M5R16_RS23505 (4792757) | 4792757..4793497 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255204 WP_004178374.1 NZ_CP103503:c4789293-4789009 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |