Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4079534..4080153 Replicon chromosome
Accession NZ_CP103503
Organism Klebsiella pneumoniae strain 5547

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5R16_RS20175 Protein ID WP_002892050.1
Coordinates 4079935..4080153 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5R16_RS20170 Protein ID WP_002892066.1
Coordinates 4079534..4079908 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R16_RS20160 (4074686) 4074686..4075879 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5R16_RS20165 (4075902) 4075902..4079048 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5R16_RS20170 (4079534) 4079534..4079908 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5R16_RS20175 (4079935) 4079935..4080153 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5R16_RS20180 (4080312) 4080312..4080878 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5R16_RS20185 (4080850) 4080850..4080990 - 141 WP_004147370.1 hypothetical protein -
M5R16_RS20190 (4081011) 4081011..4081481 + 471 WP_002892026.1 YlaC family protein -
M5R16_RS20195 (4081456) 4081456..4082907 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5R16_RS20200 (4083008) 4083008..4083706 + 699 WP_004178762.1 GNAT family protein -
M5R16_RS20205 (4083703) 4083703..4083843 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5R16_RS20210 (4083843) 4083843..4084106 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255202 WP_002892050.1 NZ_CP103503:4079935-4080153 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255202 WP_002892066.1 NZ_CP103503:4079534-4079908 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References