Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4079534..4080153 | Replicon | chromosome |
| Accession | NZ_CP103503 | ||
| Organism | Klebsiella pneumoniae strain 5547 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5R16_RS20175 | Protein ID | WP_002892050.1 |
| Coordinates | 4079935..4080153 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5R16_RS20170 | Protein ID | WP_002892066.1 |
| Coordinates | 4079534..4079908 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R16_RS20160 (4074686) | 4074686..4075879 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5R16_RS20165 (4075902) | 4075902..4079048 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5R16_RS20170 (4079534) | 4079534..4079908 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5R16_RS20175 (4079935) | 4079935..4080153 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5R16_RS20180 (4080312) | 4080312..4080878 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5R16_RS20185 (4080850) | 4080850..4080990 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M5R16_RS20190 (4081011) | 4081011..4081481 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M5R16_RS20195 (4081456) | 4081456..4082907 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| M5R16_RS20200 (4083008) | 4083008..4083706 | + | 699 | WP_004178762.1 | GNAT family protein | - |
| M5R16_RS20205 (4083703) | 4083703..4083843 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M5R16_RS20210 (4083843) | 4083843..4084106 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255202 WP_002892050.1 NZ_CP103503:4079935-4080153 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT255202 WP_002892066.1 NZ_CP103503:4079534-4079908 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |