Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 825654..826311 | Replicon | chromosome |
Accession | NZ_CP103503 | ||
Organism | Klebsiella pneumoniae strain 5547 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M5R16_RS04065 | Protein ID | WP_004181233.1 |
Coordinates | 825901..826311 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M5R16_RS04060 | Protein ID | WP_002916312.1 |
Coordinates | 825654..825920 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R16_RS04035 (820810) | 820810..822243 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
M5R16_RS04040 (822362) | 822362..823090 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M5R16_RS04045 (823140) | 823140..823451 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M5R16_RS04050 (823615) | 823615..824274 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M5R16_RS04055 (824425) | 824425..825408 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M5R16_RS04060 (825654) | 825654..825920 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M5R16_RS04065 (825901) | 825901..826311 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
M5R16_RS04070 (826318) | 826318..826839 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
M5R16_RS04075 (826940) | 826940..827836 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M5R16_RS04080 (827859) | 827859..828572 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5R16_RS04085 (828578) | 828578..830311 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T255196 WP_004181233.1 NZ_CP103503:825901-826311 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|