Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4435..5012 | Replicon | plasmid pMB9509_2 |
| Accession | NZ_CP103501 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7G3NNX6 |
| Locus tag | M5S52_RS26875 | Protein ID | WP_059065587.1 |
| Coordinates | 4680..5012 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A7G3NP82 |
| Locus tag | M5S52_RS26870 | Protein ID | WP_032454911.1 |
| Coordinates | 4435..4680 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S52_RS26855 (M5S52_26855) | 1..858 | + | 858 | WP_259430743.1 | incFII family plasmid replication initiator RepA | - |
| M5S52_RS26860 (M5S52_26860) | 2097..2732 | + | 636 | WP_023317852.1 | DUF2268 domain-containing putative Zn-dependent protease | - |
| M5S52_RS26865 (M5S52_26865) | 2868..3863 | - | 996 | WP_020326536.1 | IS110 family transposase | - |
| M5S52_RS26870 (M5S52_26870) | 4435..4680 | + | 246 | WP_032454911.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M5S52_RS26875 (M5S52_26875) | 4680..5012 | + | 333 | WP_059065587.1 | endoribonuclease MazF | Toxin |
| M5S52_RS26880 (M5S52_26880) | 5272..5595 | + | 324 | WP_021312689.1 | hypothetical protein | - |
| M5S52_RS26885 (M5S52_26885) | 5778..6032 | - | 255 | WP_009653916.1 | hypothetical protein | - |
| M5S52_RS26890 (M5S52_26890) | 6108..6365 | - | 258 | WP_004098928.1 | hypothetical protein | - |
| M5S52_RS26895 (M5S52_26895) | 6414..6617 | - | 204 | WP_004098931.1 | HHA domain-containing protein | - |
| M5S52_RS26900 (M5S52_26900) | 6651..7019 | - | 369 | WP_015344965.1 | hypothetical protein | - |
| M5S52_RS26905 (M5S52_26905) | 7063..7557 | - | 495 | WP_009310053.1 | hypothetical protein | - |
| M5S52_RS26910 (M5S52_26910) | 7588..8154 | - | 567 | WP_013023777.1 | hypothetical protein | - |
| M5S52_RS26915 (M5S52_26915) | 8151..8414 | - | 264 | WP_064175861.1 | hypothetical protein | - |
| M5S52_RS26920 (M5S52_26920) | 8634..8840 | + | 207 | Protein_13 | hypothetical protein | - |
| M5S52_RS26925 (M5S52_26925) | 9001..9945 | + | 945 | WP_020801688.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76999 | 76999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11991.87 Da Isoelectric Point: 7.7494
>T255193 WP_059065587.1 NZ_CP103501:4680-5012 [Klebsiella pneumoniae]
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G3NNX6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G3NP82 |