Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53792..54528 Replicon plasmid pMB9509_1
Accession NZ_CP103500
Organism Klebsiella pneumoniae strain 5589

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M5S52_RS26370 Protein ID WP_003026803.1
Coordinates 54046..54528 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M5S52_RS26365 Protein ID WP_003026799.1
Coordinates 53792..54058 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S52_RS26320 (M5S52_26320) 49854..50216 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M5S52_RS26325 (M5S52_26325) 50266..50616 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M5S52_RS26330 (M5S52_26330) 50974..51243 + 270 WP_004152102.1 hypothetical protein -
M5S52_RS26335 (M5S52_26335) 51231..51806 + 576 WP_004152103.1 hypothetical protein -
M5S52_RS26340 (M5S52_26340) 51837..52331 + 495 WP_004152104.1 DNA-binding protein -
M5S52_RS26345 (M5S52_26345) 52375..52743 + 369 WP_004152105.1 hypothetical protein -
M5S52_RS26350 (M5S52_26350) 52777..52980 + 204 WP_004152106.1 HHA domain-containing protein -
M5S52_RS26355 (M5S52_26355) 53029..53286 + 258 WP_004152107.1 hypothetical protein -
M5S52_RS26360 (M5S52_26360) 53362..53616 + 255 WP_004152108.1 hypothetical protein -
M5S52_RS26365 (M5S52_26365) 53792..54058 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M5S52_RS26370 (M5S52_26370) 54046..54528 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M5S52_RS26375 (M5S52_26375) 54740..56086 + 1347 WP_020314316.1 ISNCY family transposase -
M5S52_RS26380 (M5S52_26380) 56247..56378 + 132 WP_004218042.1 hypothetical protein -
M5S52_RS26385 (M5S52_26385) 56587..57752 - 1166 Protein_59 IS3 family transposase -
M5S52_RS26390 (M5S52_26390) 57929..58891 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M5S52_RS26395 (M5S52_26395) 58878..59366 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(D) / blaSHV-1 - 1..145779 145779


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T255192 WP_003026803.1 NZ_CP103500:54046-54528 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT255192 WP_003026799.1 NZ_CP103500:53792-54058 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References